PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G512600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 537aa    MW: 59635.1 Da    PI: 6.5049
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G512600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS413.12.6e-1261655351373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++++++c +av++ ++   +al+++l++++s +g+pmqRl ay++e+L arl+ +++ lyk+l+++e    +sse +++++l+++++P++
  Sevir.9G512600.1.p 165 LRQVIIACGKAVDE-NAFYMDALMSELRQMVSVSGEPMQRLGAYMLEGLIARLSFTGHALYKSLKCKEPV-ATSSELMSYMHLLYDICPFF 253
                         68999*******98.667889***********************************************97.789999************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         kf+++ aN aI +av+ge+ +HiiDf+i qG QW++++qaLasRp+  p lRiTg+++++s   +   l  +g+rL+++A+++g+pfefn+
  Sevir.9G512600.1.p 254 KFGYMSANGAIADAVKGENFIHIIDFQIAQGSQWMTMIQALASRPGRRPYLRITGIDDSNSAhaRGGGLDIVGQRLHSIAQSCGLPFEFNP 344
                         **********************************************************8888889999*********************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          v  + +++ +e+L v+pgEa++Vn+++qlh+++desv +e++rd++L++vkslsP+vv++veqea++n+++F+ r le+l+yy+a+f+++
  Sevir.9G512600.1.p 345 -VPAASHEVMYEHLCVRPGEAIVVNFAYQLHHTPDESVGIENHRDRILRMVKSLSPRVVTLVEQEANTNTAPFFLRYLETLDYYTAMFEAI 434
                         .79999999********************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         ++  pr++++ri+ E+++++r+ivn++acegaer+erhe ++kWr+rl +aGF+p+pls  +++++k+ll  ++s  yr+ee++g l+lgW
  Sevir.9G512600.1.p 435 DVARPRDDKKRISAEQHCVARDIVNLIACEGAERIERHEPFGKWRARLAMAGFRPYPLSPVVNSTIKTLLDSYHSY-YRLEERDGVLYLGW 524
                         **************************************************************************66.************** PP

                GRAS 363 kdrpLvsvSaW 373
                         k+r+Lv+ SaW
  Sevir.9G512600.1.p 525 KSRKLVVSSAW 535
                         *********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.165139517IPR005202Transcription factor GRAS
PfamPF035148.9E-124165535IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MSTQASNRSY RYPDNTQISY YNGNLVHVGG NGTYYMPQNH DDGHYISSDD GSQTSNSRAQ  60
GFQAQYCTLD SSSANCVYPA HSSTSSQSIS GSPLSQQESH SDHAYGSSPS ASCVTQVPSW  120
TLKDLENVML GPDSDIGSPD SSLLPGTALH ENNWRELLGI KTGDLRQVII ACGKAVDENA  180
FYMDALMSEL RQMVSVSGEP MQRLGAYMLE GLIARLSFTG HALYKSLKCK EPVATSSELM  240
SYMHLLYDIC PFFKFGYMSA NGAIADAVKG ENFIHIIDFQ IAQGSQWMTM IQALASRPGR  300
RPYLRITGID DSNSAHARGG GLDIVGQRLH SIAQSCGLPF EFNPVPAASH EVMYEHLCVR  360
PGEAIVVNFA YQLHHTPDES VGIENHRDRI LRMVKSLSPR VVTLVEQEAN TNTAPFFLRY  420
LETLDYYTAM FEAIDVARPR DDKKRISAEQ HCVARDIVNL IACEGAERIE RHEPFGKWRA  480
RLAMAGFRPY PLSPVVNSTI KTLLDSYHSY YRLEERDGVL YLGWKSRKLV VSSAWC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-611675356374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0672840.0BT067284.1 Zea mays full-length cDNA clone ZM_BFb0379I09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985375.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLK4A8830.0K4A883_SETIT; Uncharacterized protein
STRINGSi035089m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein